Protein Info for Echvi_4471 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: High-affinity Fe2+/Pb2+ permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 651 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 385 to 413 (29 residues), see Phobius details amino acids 425 to 445 (21 residues), see Phobius details amino acids 460 to 478 (19 residues), see Phobius details amino acids 503 to 528 (26 residues), see Phobius details amino acids 540 to 560 (21 residues), see Phobius details amino acids 571 to 593 (23 residues), see Phobius details amino acids 614 to 638 (25 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 134 to 216 (83 residues), 41.6 bits, see alignment E=1.9e-14 PF00034: Cytochrom_C" amino acids 136 to 219 (84 residues), 50.3 bits, see alignment E=7.3e-17 PF03239: FTR1" amino acids 395 to 597 (203 residues), 85 bits, see alignment E=8.6e-28

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G6M7 at UniProt or InterPro

Protein Sequence (651 amino acids)

>Echvi_4471 High-affinity Fe2+/Pb2+ permease (Echinicola vietnamensis KMM 6221, DSM 17526)
MIRNSLYTIFTVGVLLCIFPYNAMASQDDSNLRTSIHLLDYISRDYTAAVQNGEVIDEGE
FAEMQEFSDKVYVLIEESKLPQDDKLRMLSQLKELGKQIEKKAPHQSIYNLAQQTRQDII
KTTGLKTAPLIWPDLKNGKSLYVQNCTSCHGVNGAGDGKLAAGLKPAPTNFLNDTLMQEI
SSFQAYNTIKLGVEGTAMQSFATLSDKEIWDLAFYIKALRFTPQADKNSELQQKFDRANN
TVNLEEVATLSDVELVKRLSNNDSADKELLLTALRTQSPGDNAQKYSLDKARNYLKSALQ
NYTSGSYSSAREDALAAYLEGIEPSEARLKANAPAFTARLEQQMFKIREVIENKGDKAQV
EKEIDNGLAMLGQAEELMQDKKLNYWLSFALSASIMLREGLEAFLILALILALIRSSGLK
KAIPWVHGGWITAILLGVAGWFFSDWVIGISGKNREIMEGMISLVAVIVLAFVGFWLHDH
SHAKKWKKFIEEKIGKQLKKDKMFGIAFFSFMVVFREAFESILFLQAISLETQPAHQSSI
GLGVLAAFVMISLFAVLFVRYSKKIPVRQLFRYSAWAITLLALILIGKGVHSIQEAGWLS
VTGFPVSVSVDLLGIYPTIETVAAQVALLVLMLLLYFWSNHKTKIRSTKLN