Protein Info for Echvi_4463 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 189 to 206 (18 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 17 to 297 (281 residues), 243.8 bits, see alignment E=1.1e-76 PF01545: Cation_efflux" amino acids 21 to 214 (194 residues), 162.3 bits, see alignment E=1.2e-51 PF16916: ZT_dimer" amino acids 219 to 295 (77 residues), 75.4 bits, see alignment E=3.1e-25

Best Hits

KEGG orthology group: None (inferred from 55% identity to gfo:GFO_1752)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G5S0 at UniProt or InterPro

Protein Sequence (311 amino acids)

>Echvi_4463 cation diffusion facilitator family transporter (Echinicola vietnamensis KMM 6221, DSM 17526)
MKENKRNPNAISEKGLKTTLTGIVVSALLAIVKALGGIFGHSYALIADAIESGTDVVTSG
MLWLGLRWSTKPADENHPYGHGKAEALVALGISLALVGAAFIIIKDSIAHIQSPHKTPAP
YTLIILVVVVVTKELLYRFVLKTGEEIQSGAVKADAFHHRSDAITSVAAFIGISIALWGG
EGYEVADDYAALIAAAFIIYNAYGIGRPAIGELLDEELEPEFHKEVTHLAEQIPEVEKVE
QCHSRKMGPAFHVDLHIWVDGKLSVDEGHQVAHKVKESLVENIPQIIDVHIHVEPTKKLK
SYATNTGIDKR