Protein Info for Echvi_4461 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Na+/H+ antiporter NhaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 30 to 48 (19 residues), see Phobius details amino acids 68 to 92 (25 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 195 to 212 (18 residues), see Phobius details amino acids 220 to 251 (32 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 345 to 369 (25 residues), see Phobius details amino acids 384 to 409 (26 residues), see Phobius details amino acids 420 to 440 (21 residues), see Phobius details PF06965: Na_H_antiport_1" amino acids 21 to 437 (417 residues), 461.3 bits, see alignment E=1.1e-142 TIGR00773: Na+/H+ antiporter NhaA" amino acids 22 to 434 (413 residues), 401.6 bits, see alignment E=1.7e-124

Best Hits

Swiss-Prot: 75% identical to NHAA_GRAFK: Na(+)/H(+) antiporter NhaA (nhaA) from Gramella forsetii (strain KT0803)

KEGG orthology group: K03313, Na+:H+ antiporter, NhaA family (inferred from 75% identity to gfo:GFO_1203)

Predicted SEED Role

"Na+/H+ antiporter NhaA type" in subsystem Na(+) H(+) antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G6L9 at UniProt or InterPro

Protein Sequence (447 amino acids)

>Echvi_4461 Na+/H+ antiporter NhaA (Echinicola vietnamensis KMM 6221, DSM 17526)
MDRSIKNNQSTIAYIQQTARRFLNRETSGGLLLIAATILALILGNSQWADAYHHYLKDEF
LFELSEHFTFGLTIEEWINDGLMAIFFLVAGLELKREIMVGELSSFKKASMPLLAALGGM
AMPAIIFTMLNSGTVNINGWGIPMATDIAYSLGIIGLLGRRVPAQLKIFLVALAIADDLG
AILVIALFYSNQLSWLYLGTGAGIFILLMLFNRLGIKNLFWYLLGGVGLWYCFLNSGVHP
TIAGVLFAITIPVKPKLDSKLLKDRTARNVERLEETDIETRDPLQDVRQGKILKDIKKDT
ENAKPPLLKLENALIDFNAFFIIPIFAIANAGVKLDVSFLEVVSGSLGLGILLGLAVGKV
LGISLFAFIGEKLGIAELHISLRWGHIIGMGMIAGIGFTMSLFITNLAFSDPELVKVSKI
SILIASLIGALGGIITLLFTKPKNENL