Protein Info for Echvi_4437 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: FOG: Transposase and inactivated derivatives

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 333 to 348 (16 residues), see Phobius details PF14294: DUF4372" amino acids 9 to 80 (72 residues), 85.5 bits, see alignment E=2.5e-28 PF01609: DDE_Tnp_1" amino acids 127 to 341 (215 residues), 99.1 bits, see alignment E=3e-32

Best Hits

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>Echvi_4437 FOG: Transposase and inactivated derivatives (Echinicola vietnamensis KMM 6221, DSM 17526)
MGKSSNFSGQPIFNQLIKFIDKGEVREIARRHNAERYVKKFTTYNHLIVMLFVAFEGYHS
IRETLVGLLANAHRLAHLGLNYVVRRSTLSEANKRRVSDVFADIYMSVYQRHGDSLTDSR
LKDADMKRLYIMDSTTISLFKDILKGVGRNPKTGKKKGGIKAHTIIRASDHVPYLVRYSA
AVRHDHTFLDEVFNLPGGSIITFDKGYVDYGKYEVLTESGIWYVTRLKDNAVYQARKEFN
IPDQADSGVLKDEEIILRYGKNKQQEHRSRRIAYWDSKSERLFEFITNNFEMAAEKIALI
YKRRWQIELLFKQLKQNFPLKYFLGDNENAIEIQIWSAMLANLLLTLIKSQVKRKWAFSN
LVSLVRQQLMNYISLYRFLEDPEGSWRAIIQEDILKNQNTLFPEMRGACS