Protein Info for Echvi_4412 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 312 to 332 (21 residues), see Phobius details amino acids 344 to 363 (20 residues), see Phobius details amino acids 376 to 398 (23 residues), see Phobius details amino acids 405 to 422 (18 residues), see Phobius details amino acids 434 to 458 (25 residues), see Phobius details amino acids 464 to 486 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 42% identity to bvu:BVU_2391)

Predicted SEED Role

"Membrane protein involved in the export of O-antigen, teichoic acid lipoteichoic acids"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G6H9 at UniProt or InterPro

Protein Sequence (509 amino acids)

>Echvi_4412 hypothetical protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MSSKNTRIAKNSLSLYLRMLITMGVSLYTARVVLQTLGVSDYGLNTVVGGVVTMFSFLSG
TMASATQRFLNYEQGTEDDNSLRKVFSTSLYIHYLIALVVLVLAETAGLWFLNTRLNIPE
GRMVAANWVYQFSILSFVLTVVNVPYNAAIIANERMTAFAYISVIDVVLKLLIVYLLQLF
MVDKLILYGFLTFCVTFAVRMAVRWYSRKNFEECRVGVSKDETFFKKMMGFSGWTMMSSV
SVVLRNQGIAVVLNMFFGTVVNAAQGISNQINTVVTTFARNFTQAVNPQIVKQYAAGDLT
GMKKLLVTSVKMSFFLILLISLPIFIEAPFILKLWLGEVPEHTVVFVRLVMVRALIESYA
NPVATAQAATGKVRNYHITLSVIGLMNLPISYVMLMMGYEPESTLVVAILLSALISFIRV
SFLRKSIGFKFRDFLTGVLLPSVVVIILAVPIPGYLYYVMPANVVNFIIKVLCACATVLA
AVYLVGLSKQERNFINNIVIKKILGKRKK