Protein Info for Echvi_4410 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: nucleotide sugar dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF03721: UDPG_MGDP_dh_N" amino acids 1 to 187 (187 residues), 224.4 bits, see alignment E=1.9e-70 TIGR03026: nucleotide sugar dehydrogenase" amino acids 1 to 419 (419 residues), 467.3 bits, see alignment E=2.1e-144 PF02737: 3HCDH_N" amino acids 2 to 48 (47 residues), 22.1 bits, see alignment 2.5e-08 PF00984: UDPG_MGDP_dh" amino acids 205 to 296 (92 residues), 128.8 bits, see alignment E=1.4e-41 PF03720: UDPG_MGDP_dh_C" amino acids 320 to 423 (104 residues), 117.8 bits, see alignment E=5.3e-38

Best Hits

Swiss-Prot: 49% identical to TUAD_BACSU: UDP-glucose 6-dehydrogenase TuaD (tuaD) from Bacillus subtilis (strain 168)

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 67% identity to chu:CHU_3394)

MetaCyc: 49% identical to UDP-glucose 6-dehydrogenase (Bacillus subtilis subtilis 168)
UDP-glucose 6-dehydrogenase. [EC: 1.1.1.22]

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.22

Use Curated BLAST to search for 1.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G308 at UniProt or InterPro

Protein Sequence (438 amino acids)

>Echvi_4410 nucleotide sugar dehydrogenase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKITVVGTGYVGLVSGACFADVGIEVVCVDIDQKKIDKLKNGIMPIYEPGLEEIVTRNYK
DGRLSFSTNLGEAIQGSEVAFIAVGTPPGEDGSADLKYVLAVADEIGRTMSDYIVVATKS
TVPVTTGCKVKEAIQQALDKRKSDLPFAVASNPEFLKEGAAVEDFLKPDRIIIGVEDERA
EEIMKRLYKPFQLSGDRIIYMDIPSAEMTKYTANAMLATKISFMNDIANLCELVGADANM
VRAGIGSDPRIGNKFIYPGVGYGGSCFPKDVKAIIRTAKTYGYDLRVLQSVEAVNDDQKH
RLVHKIKQHFGDDLSGMTFAMWGLSFKPNTDDMREAPAIVMINELRAAGAKVKAYDPIAM
EEAKEVYVGDKVTYCDDAYDACVDADALLLVTEWSQFRMPSWSALGKLLSNKVVFDGRNI
YDKKYLAELGFTHYGIGI