Protein Info for Echvi_4400 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: nucleotide sugar dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 11 to 427 (417 residues), 384.8 bits, E=2.2e-119
• PF03721: UDPG_MGDP_dh_N
  • amino acids 12 to 197 (186 residues), 107.7 bits, E=8.6e-35
• PF00984: UDPG_MGDP_dh
  • amino acids 219 to 307 (89 residues), 91 bits, E=6.8e-30
• PF03720: UDPG_MGDP_dh_C
  • amino acids 334 to 430 (97 residues), 86.4 bits, E=2.3e-28

Best Hits

KEGG orthology group: K02474, UDP-N-acetyl-D-galactosamine dehydrogenase [EC: 1.1.1.-] (inferred from 66% identity to shg:Sph21_1811)

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• UDP-α-D-xylose biosynthesis (2/2 steps found)
• UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (3/6 steps found)
• UDP-sugars interconversion (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (3/9 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Starch and sucrose metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-, 1.1.1.22

Use Curated BLAST to search for 1.1.1.- or 1.1.1.22

Sequence Analysis Tools

See L0G2Z9 at UniProt or InterPro

Protein Sequence (439 amino acids)

>Echvi_4400 nucleotide sugar dehydrogenase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNTALLPLHQSKIAVIGLGYVGLPLAVELAKYYPTVGYDISPKRIEGLEEGHDFTLEVED
EKLQSSLVKSSIGLDHKGKGFLPSNDVSEISSCNIFIVTVPTPINEHKTPDLQPLIAAST
MLGKLLKKGDVVIYESTTYPGCTEEDCVPILERESGLIFNQDFYCGYSPERINPGDKVNT
LTKIKKVTSGSTPEVADYVNELYASIIEAGTYKASSIKVAEASKAIENAQRDVNISFVNE
LALIFDRLGIDTNEVLEAAGTKWNFLKYKPGLVGGHCIGVDPYYLAHKAEQVGYHPAVIL
SGRRVNDNMGMFVANKVIKLMIQKGKTIKGSKALILGFTFKENCPDIRNTRVIDIYKELN
QFGLEVDVYDPWASREEVQEEYGIQLTSKNKLSKYDAVILAVGHKEFSDMDLEDIKTNGL
SVLYDTKAFYRKDLVHGRL