Protein Info for Echvi_4398 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: GDP-mannose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 67% identical to GM4D_YERE8: GDP-mannose 4,6-dehydratase (gmd) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K01711, GDPmannose 4,6-dehydratase [EC: 4.2.1.47] (inferred from 82% identity to rbi:RB2501_06715)

Predicted SEED Role

"GDP-mannose 4,6-dehydratase (EC 4.2.1.47)" in subsystem Capsular heptose biosynthesis or Colanic acid biosynthesis (EC 4.2.1.47)

MetaCyc Pathways

colanic acid building blocks biosynthesis (9/11 steps found)
GDP-L-fucose biosynthesis I (from GDP-D-mannose) (3/3 steps found)
GDP-6-deoxy-D-talose biosynthesis (1/2 steps found)
GDP-D-perosamine biosynthesis (1/2 steps found)
GDP-D-rhamnose biosynthesis (1/2 steps found)
GDP-L-colitose biosynthesis (3/5 steps found)
GDP-N-acetyl-α-D-perosamine biosynthesis (1/3 steps found)
GDP-N-formyl-α-D-perosamine biosynthesis (1/3 steps found)
GDP-mycosamine biosynthesis (1/3 steps found)
superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (8/14 steps found)
superpathway of candicidin biosynthesis (4/11 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G4X1 at UniProt or InterPro

Protein Sequence (371 amino acids)

>Echvi_4398 GDP-mannose 4,6-dehydratase (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKVALITGVTGQDGAYLSEFLLKKGYLVHGIKRRSSLFNTDRIDHLYQDPHEENRNFFL
HYGDMTDSTNLIRLIQEIQPDEIYNLAAMSHVHVSFETPEYTANADGLGTLRILEAIRLL
GLESKTKIYQASTSELYGKVQEVPQKETTPFYPRSPYAVAKMYAYWITVNYREAYGIYAC
NGVLFNHESPIRGETFVTRKITRAVSKIALGLQDKFYLGNLDSKRDWGHAKDYVRMMWMI
LQAEKAEDWVIATGITTTVRDFVRMAFSYVGIELDFQGDGENEVALVKACNNPEYQIPIG
KEILSVDPKYYRPTEVDLLIGDYSKAKKKLGWEPKYDLSDLIDEMMESDLKLMTKQQFLK
SGGYEIKNYYE