Protein Info for Echvi_4395 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Membrane protein involved in the export of O-antigen and teichoic acid

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 10 to 31 (22 residues), see Phobius details amino acids 43 to 59 (17 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 222 to 240 (19 residues), see Phobius details amino acids 247 to 270 (24 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 331 to 353 (23 residues), see Phobius details amino acids 365 to 384 (20 residues), see Phobius details amino acids 390 to 412 (23 residues), see Phobius details PF01943: Polysacc_synt" amino acids 17 to 267 (251 residues), 40.8 bits, see alignment E=2.8e-14 PF13440: Polysacc_synt_3" amino acids 73 to 325 (253 residues), 56.4 bits, see alignment E=4.3e-19 PF03023: MurJ" amino acids 81 to 322 (242 residues), 32.9 bits, see alignment E=4.3e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2Z6 at UniProt or InterPro

Protein Sequence (417 amino acids)

>Echvi_4395 Membrane protein involved in the export of O-antigen and teichoic acid (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKSSYFRLIANQAIYVIIAQLIPVICSPILTRVYDENGMAEVTGLVSLCSILIVASTGK
LENALVLEKNKGRIKDVLGLNTLFAFIFFVIVFALVFIFKDFLVRSFKLNHTVYLVPFYV
LFYAFFNILNYWFIREKKFTLKAISKIVESIIYVALALLVAKVFGRNEFGLAIGKITGVI
IGCLFLFLKAKSSLPVVKYNFKSMKNIFLKYKDFPLHNVPSNMINIVGIQLIVVFLGIYY
TKEEVGYFGLANMIVVLPVSFVAQTISNIFFEKVVESFKSGKVSEVKSTFLNTLGILLLF
GIPVFLTLKFYGEDIIVLIFGKDWEISGKVVEIISLVFISQILVSPLGIILVGINKIKLN
AYWQYGRFILMVFLLFIGADLLRLDYFDLLFLYSIGVLVSYVFYLVIIFKSVFGLGK