Protein Info for Echvi_4391 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Nucleoside-diphosphate-sugar epimerases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF04321: RmlD_sub_bind" amino acids 2 to 204 (203 residues), 53 bits, see alignment E=1e-17 PF01370: Epimerase" amino acids 3 to 210 (208 residues), 104.1 bits, see alignment E=2.9e-33 PF16363: GDP_Man_Dehyd" amino acids 4 to 241 (238 residues), 46.6 bits, see alignment E=1.2e-15 PF01073: 3Beta_HSD" amino acids 4 to 202 (199 residues), 86.7 bits, see alignment E=5.2e-28 PF13460: NAD_binding_10" amino acids 6 to 167 (162 residues), 32.8 bits, see alignment E=2.2e-11 PF02719: Polysacc_synt_2" amino acids 44 to 246 (203 residues), 24.6 bits, see alignment E=4.6e-09 PF07993: NAD_binding_4" amino acids 57 to 189 (133 residues), 41.2 bits, see alignment E=4.1e-14

Best Hits

Swiss-Prot: 48% identical to GNU_ECO57: N-acetyl-alpha-D-glucosaminyl-diphospho-ditrans,octacis-undecaprenol 4-epimerase (gnu) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 62% identity to tde:TDE1439)

MetaCyc: 48% identical to N-acetyl-alpha-D-glucosaminyl-diphospho-ditrans,octacis-undecaprenol 4-epimerase (Escherichia coli O157)
RXN-14572 [EC: 5.1.3.26]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G6V7 at UniProt or InterPro

Protein Sequence (326 amino acids)

>Echvi_4391 Nucleoside-diphosphate-sugar epimerases (Echinicola vietnamensis KMM 6221, DSM 17526)
MISIIGGSGFIGTRLSNRLISSGKDIVIIDKRSSGTFPDLWKYSDVREFDVLSKAIQGDV
IINLAAEHRDDVTPLSLYDEVNVEGAKRVCEVAEEKGINRIIFTSSVAVYGFAPIGTDES
GDINYFNDYGRTKYLAEQVYKEWQKRDSQNRTLVIVRPTVVFGEQNRGNVYNLLKQIASG
KFMMVGNGENVKSMAYVENVAAFLEYSLDFKSGIHIYNYIDKPDFTMNTLVKKVFKALGK
EEKVGIRIPYSIGYGMGKILDLGAKISGKKLPISSIRVKKFCSNTSFNTSIVKSGFEAPV
SIEEGLSQTIKYEFVDRKKGEVFFTE