Protein Info for Echvi_4374 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Thiol-disulfide isomerase and thioredoxins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00578: AhpC-TSA" amino acids 48 to 139 (92 residues), 39 bits, see alignment E=1.5e-13 PF08534: Redoxin" amino acids 49 to 166 (118 residues), 31.9 bits, see alignment E=2.2e-11 PF00085: Thioredoxin" amino acids 75 to 120 (46 residues), 25.6 bits, see alignment 2e-09 PF13905: Thioredoxin_8" amino acids 75 to 163 (89 residues), 28.7 bits, see alignment E=2.8e-10

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G5I9 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Echvi_4374 Thiol-disulfide isomerase and thioredoxins (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKIIYLCLLAYLCLYGKAALAQLKLNEDPSTEENKFSDLQDLKPLEIGDRVPDLAIENV
INHREGELRISDYRGKLLILDFWATWCAPCVKGMPKIAALDQELDEVAILPVTYQDKEEV
EKLFSRLDYLKEVSMPMAVSDEQLRKLFPHRTLPHYVWINGEGVVIAFTGKEAVAKDSIR
QVLEGEEMLETKEPPKALFDRNQLLLMGNHGFDEDKEILLQSVFLPYIKDMPAMYKVSGK
PDRSRMRILLTNSTIPTFFGLAYGVGKVEFNRNRRALEVDDPGKLRHSLSRDDYDEWKLA
NRFCYELLVSPKYPGQEYDIMKEDLKRMFPQYKATIEERKTEVLALVRTDDSIRLGTAGG
EPYSDMDYVGASLKNKKISLLAYYWRYYLQHLKLPIIDATGMDYPVDILLEGKMSDLGEI
RKCLRPYGLDLIKKKMPIDILVIRDSERKNDN