Protein Info for Echvi_4365 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 48 to 66 (19 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details PF13572: DUF4134" amino acids 11 to 100 (90 residues), 129.8 bits, see alignment E=1.7e-42

Best Hits

KEGG orthology group: None (inferred from 68% identity to fjo:Fjoh_3548)

Predicted SEED Role

"Conjugative transposon protein TraE" in subsystem Conjugative transposon, Bacteroidales

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2X0 at UniProt or InterPro

Protein Sequence (101 amino acids)

>Echvi_4365 hypothetical protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MTHNQLSKGLLILLLTGISLSAFGQDGNAGIMEATTKVRSYFQSGVNLMYAIGAIVGLIG
AVKVFNKWNSGEPDTGKVAAAWFGSCVFLVIVATVLTSFFG