Protein Info for Echvi_4312 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Na+/proline symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 124 to 149 (26 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 186 to 211 (26 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details amino acids 270 to 292 (23 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 366 to 387 (22 residues), see Phobius details amino acids 393 to 416 (24 residues), see Phobius details amino acids 424 to 443 (20 residues), see Phobius details amino acids 453 to 472 (20 residues), see Phobius details PF00474: SSF" amino acids 33 to 429 (397 residues), 108.3 bits, see alignment E=2.3e-35

Best Hits

KEGG orthology group: None (inferred from 62% identity to psn:Pedsa_0686)

Predicted SEED Role

"putative sodium-coupled permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G6P0 at UniProt or InterPro

Protein Sequence (490 amino acids)

>Echvi_4312 Na+/proline symporter (Echinicola vietnamensis KMM 6221, DSM 17526)
MELLDWIVLGLYFVMLLSIGLWAYFRVRNSEDFYTAGGRLPWWLSGISHHVSGYSGAVFV
AYAGIAYTHGFTIYVWWALTVAIAVLVAAFYIAPRWARLRVTFGVQSPTEYLLIRYNLPT
QQMIAWIGTVIKIFDTGGKLAAIAILLNVFSGTSITFGILLVGFISLIYITIGGLWADVW
NDFGQFIIQLLAGLTMFVMVLFKLGDGISGIFTLWDRLPESHGAFFHDPYTIGFAAAMLM
INFFSYSGGTWNLATRFISTTSGKVAKKAALLSSVLYFIWPLVLFYPMFAAPVFFENLVD
PTLSYGKMVLEFLPNGLIGLVLASLFANTLSMTASDSNTVSAVISRDILPVLFPQVKRFS
KAQALTLARVTTLCFTILTIVIAVNAAHFGGVFGLMISWFAALLGPIAIPMILGLLPAFK
RSGAMSAMIAVFSGLFTFVLLKICPVGSLAVEIGAPTLVAFLTFVVTGLFGTGEISPEVD
QLIDGLSNQD