Protein Info for Echvi_4304 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00561: Abhydrolase_1
  • amino acids 31 to 141 (111 residues), 58.3 bits, E=1.5e-19
• PF12697: Abhydrolase_6
  • amino acids 52 to 246 (195 residues), 35.4 bits, E=2.8e-12
• PF12146: Hydrolase_4
  • amino acids 57 to 243 (187 residues), 35.3 bits, E=1.2e-12

Best Hits

KEGG orthology group: K01055, 3-oxoadipate enol-lactonase [EC: 3.1.1.24] (inferred from 52% identity to mlo:mll2481)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

• catechol degradation to β-ketoadipate (2/4 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (1/4 steps found)
• catechol degradation III (ortho-cleavage pathway) (2/6 steps found)
• superpathway of salicylate degradation (2/7 steps found)
• 4-methylcatechol degradation (ortho cleavage) (1/7 steps found)
• aromatic compounds degradation via β-ketoadipate (2/9 steps found)
• toluene degradation III (aerobic) (via p-cresol) (1/11 steps found)
• mandelate degradation to acetyl-CoA (2/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (5/35 steps found)
• superpathway of aerobic toluene degradation (1/30 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.24

Sequence Analysis Tools

See L0G6N1 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Echvi_4304 Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) (Echinicola vietnamensis KMM 6221, DSM 17526)
MVKKNGLDRKYFTTQDGCEIVYKIDGEVTNPVLVLSNSIATDLAMWDGQVEAFCKSYRLL
RFDTRGHGLSESPVGDYSVARLAKDVIELMDYLGIEKAHFCGLSLGGFIGQWLGVHVPHR
LDKLILANTSPYLGPDTIWNENIHLLRNGSDMSHFEELFINGWFPKQMINNQKNRVVPFR
KMILSTSPIGLAGAYAAVRDADFRKTNALIPNKTLILAGEHDQVTKPEHSKLMHEVIRGA
TLKVLPVVHLSNIERINEFERLVLQFLSSP