Protein Info for Echvi_4297 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 PF00756: Esterase" amino acids 22 to 163 (142 residues), 22.1 bits, see alignment E=2.9e-08 PF12146: Hydrolase_4" amino acids 24 to 263 (240 residues), 68.6 bits, see alignment E=1.4e-22 PF00561: Abhydrolase_1" amino acids 24 to 263 (240 residues), 84.9 bits, see alignment E=1.8e-27 PF12697: Abhydrolase_6" amino acids 26 to 264 (239 residues), 47.9 bits, see alignment E=6.7e-16

Best Hits

KEGG orthology group: K01044, carboxylesterase [EC: 3.1.1.1] (inferred from 53% identity to bcq:BCQ_2585)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.1

Use Curated BLAST to search for 3.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G594 at UniProt or InterPro

Protein Sequence (281 amino acids)

>Echvi_4297 Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) (Echinicola vietnamensis KMM 6221, DSM 17526)
MKEQLVKNNEVEIFTQSFGEEKNPAILLISGATVSMLYWDEEFCTQLAANGFFVIRFDNR
DVGKSTFYEPGEAQYDIVDLTNDVIAILDDYEIDQAHLVGMSLGGLISQIAAINYPERIQ
TMTLFATGPWGDSDPSIPEMDTRILDFHSKASSVDWTNEDSVVTYLIKGSQLMSGKKEFE
RERIENLIRAEFNRANNYISMFNHATLAGGEKFWDRLDEIQQPTLVIHGTEDKIWHYRNA
SVLVRKIKKSKLLTLEGTGHELHSQDWNVIIEGIKKHIKGD