Protein Info for Echvi_4295 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted RNA polymerase sigma factor containing a TPR repeat domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 PF04542: Sigma70_r2" amino acids 15 to 81 (67 residues), 36.1 bits, see alignment E=4.6e-13 PF20239: DUF6596" amino acids 187 to 288 (102 residues), 115.5 bits, see alignment E=1.3e-37

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 70% identity to chu:CHU_2476)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G662 at UniProt or InterPro

Protein Sequence (414 amino acids)

>Echvi_4295 Predicted RNA polymerase sigma factor containing a TPR repeat domain (Echinicola vietnamensis KMM 6221, DSM 17526)
MKSQVSHRELVPHLFRQEYAKMTAILCRHFGLKHMEIAEDITSDTFLKASEHWAINGVPE
NPTAWLYTVAKNKARDYFKRTDVFEKQIMPDLKSGDTEPSEMVSFDDQLISDSQLAMIFA
VCHPANSGESQIALALQILCGFSVEEIANAFLSKRDTIKKRLQRARNNLRNTDFQIKTLS
TTEIQSRQGTVLKTLYLLFNEGYYSTSGNKFIRKELCSEAIRLMLVLTENPLTNSAQTNA
LMALMCFQSSRIEARTDENGEVILFDEQDKNLWDMSLIERGIYYLVNATNGKETSKYHLE
AGIAYWHTTQHGDKWGNILRLYNQLLLMEYSPITALNRTFAFSKVYGHQMAIAEAEKLGI
RESSQYYELLGYLYAQSDKIKAIQYYEAAIKHTKSNTKKATLKREIERLQKIIW