Protein Info for Echvi_4291 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Dihydrofolate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01872: RibD_C
  • amino acids 2 to 169 (168 residues), 65.3 bits, E=3.4e-22

Best Hits

KEGG orthology group: None (inferred from 73% identity to fba:FIC_01203)

Predicted SEED Role

"Dihydrofolate reductase (EC 1.5.1.3)" in subsystem Folate Biosynthesis (EC 1.5.1.3)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (12/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (10/10 steps found)
• folate transformations III (E. coli) (8/9 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• folate transformations II (plants) (8/11 steps found)
• superpathway of chorismate metabolism (42/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 1.5.1.3

Use Curated BLAST to search for 1.5.1.3

Sequence Analysis Tools

See L0G590 at UniProt or InterPro

Protein Sequence (178 amino acids)

>Echvi_4291 Dihydrofolate reductase (Echinicola vietnamensis KMM 6221, DSM 17526)
MRKVKLFIATSLDGFIAQPNDDLSFLKLVEKEGEDYGYTAFTSTVDTIIIGRKTYDYVVK
EIGASHYDNGKRDVYVVTRTDRPDSGRIKFYSGSLVDLIAKLKSKKGKDIYCDGGAEVVN
ELLKNDLIDELTISIVPILVGNGTRLFKEGRPEQLLEFVSAKTFDTGLVQLYYKRKKI