Protein Info for Echvi_4280 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 46 to 64 (19 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details PF13564: DoxX_2" amino acids 12 to 110 (99 residues), 53.2 bits, see alignment E=1.4e-18

Best Hits

KEGG orthology group: None (inferred from 66% identity to shg:Sph21_5049)

Predicted SEED Role

"FIG01092320: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G580 at UniProt or InterPro

Protein Sequence (126 amino acids)

>Echvi_4280 hypothetical protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKYKTIFWIATSVIFVMEALMPLATLLFAHEYFNAGTKPLGYPDYFAYTLIVCKILGAS
AIMLPKLPVKLREWAYAGLSFNLIFATISHMAVDQVMANIAMPIVVGIVLGISYSYSQKI
KLQSIN