Protein Info for Echvi_4240 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: nucleotidyltransferase substrate binding protein, HI0074 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 PF08780: NTase_sub_bind" amino acids 13 to 132 (120 residues), 118.5 bits, see alignment E=9.7e-39 TIGR01987: nucleotidyltransferase substrate binding protein, HI0074 family" amino acids 14 to 132 (119 residues), 88.5 bits, see alignment E=1.8e-29

Best Hits

KEGG orthology group: None (inferred from 50% identity to geo:Geob_3291)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G612 at UniProt or InterPro

Protein Sequence (146 amino acids)

>Echvi_4240 nucleotidyltransferase substrate binding protein, HI0074 family (Echinicola vietnamensis KMM 6221, DSM 17526)
MENDHKDTRWGQGFANFKKAFGQLEKFVNHGSLNEMEEQGLIKAFEYTYELGWKTLQDLL
AHKGYQGITGPKPVIEQCFSDGYIADGKGWARIQKSRNLTSHTYNDKTAREIVIGIKSEY
VKLLQDLNLKLEAERSGNQGAIFEGE