Protein Info for Echvi_4238 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Sugar transferases involved in lipopolysaccharide synthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 transmembrane" amino acids 54 to 77 (24 residues), see Phobius details PF02397: Bac_transf" amino acids 52 to 234 (183 residues), 211 bits, see alignment E=5e-67

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2H9 at UniProt or InterPro

Protein Sequence (239 amino acids)

>Echvi_4238 Sugar transferases involved in lipopolysaccharide synthesis (Echinicola vietnamensis KMM 6221, DSM 17526)
MTNHNQEIHFNRAVTTTAAIPDLFTLSDMITRDRLQSGILNLQMDTTTKVIKRVFDIFFA
VTVLLLGAPVYLALMAMTKLTSKGPIFYKQERIGENGRPFEIYKFRSMYTDAEKNGPQLT
RGNDPRVTRWGSFMRKTHLDEIPQFYNVLKGDMSIVGPRPEREHFINQIVSVSPSYKKLQ
GIKPGITSIGQVYYGYAETVQEMVERMKYDLLYLTGPSLKTDMFIIYQTVKVMVNGKGQ