Protein Info for Echvi_4230 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Membrane protein involved in the export of O-antigen and teichoic acid

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 45 to 70 (26 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details amino acids 226 to 246 (21 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details amino acids 350 to 371 (22 residues), see Phobius details amino acids 378 to 398 (21 residues), see Phobius details amino acids 404 to 425 (22 residues), see Phobius details amino acids 437 to 458 (22 residues), see Phobius details amino acids 469 to 492 (24 residues), see Phobius details PF13440: Polysacc_synt_3" amino acids 41 to 346 (306 residues), 41.1 bits, see alignment E=2e-14 PF14667: Polysacc_synt_C" amino acids 351 to 486 (136 residues), 30 bits, see alignment E=7.9e-11

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G602 at UniProt or InterPro

Protein Sequence (508 amino acids)

>Echvi_4230 Membrane protein involved in the export of O-antigen and teichoic acid (Echinicola vietnamensis KMM 6221, DSM 17526)
MAGQSPVKKIFSGSVWGIAAKVLDALAKFVTIPLLVSFYGKTDYGLIALAFSLNAYLRLM
DLGMNIGSVRYFAMWESKGEYDKIATASRSSMVFYGLIGLVNALIFVWMADHGPDFFNIS
QDQAPTYRIMMYILAASTVFNWLSNVVIQLLSAKDELGFVHRITVISSVLNFLIALAAIH
FQWSLEVYFLFYTLSLMVVIPLNVLRLKRYPLPLRKLLLPKWDGKVFKQILGYSMAIFAM
GLFQFSAKELRPILLAKFATGIDVLTDYRVIQTIANLVMSFGSIFLQVLLPSASKAHAEN
DQHKMEKMVFEATRYIAIFLTLVVFALILNAENLLVLYMGESYADLSKWLIIWLLTVLLS
MHNTPVASLVLSSGKTKALVYSAAIGCILSLPITVVFAPEMGVGAAVMGYLVYMLIQMGF
FYFYYIPKVLHMSSARIFFKAFSPSLLGAVLAWFLAYLTGTLVDLAQPYLAMALQTTVFL
LVFAGFHGAFVIKRSDIDYLKSKLSPQP