Protein Info for Echvi_4215 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): lysine/tyrosine outer membrane transporter, accessory component
Rationale: Specifically important in nitrogen source L-Lysine; nitrogen source L-tyrosine disodium salt. Echvi_4215 is an outer membrane lipoprotein that has very similar phenotypes as an adjacent TonB-dependent receptor (Echvi_4214). Jackhmmer searches found that Echvi_4215 is distantly related to DUF4374; both Echvi_4215 and DUF4374 have conserved proximity to TonB-dependent receptors. Echvi_4215 and relatd proteins are probably accessory proteins for uptake, analagous to the SusD family, but not homolgous. (SusD-like proteins are not found in proximity to Echvi_4214 or its homologs.)
Original annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 57% identity to fjo:Fjoh_4072)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G5Y5 at UniProt or InterPro

Protein Sequence (444 amino acids)

>Echvi_4215 lysine/tyrosine outer membrane transporter, accessory component (Echinicola vietnamensis KMM 6221, DSM 17526)
MLRTNMLKSKILHMGAVVAALSLTSCNNEDDPTPQPEQNADRWVTVAGALMGDSPGDGNG
GTKIYAVSYEDAINPEIEIDVFDNGEPVKSNRTARLQISEDGSTLFNIAYGGENGGEFSK
FDVAGGSSYVQQDVTVNISQYVGTAPRWSKLYNGDQNGIAVNVANIAANNAAENSTEPFQ
YYRGTATVLDVDLQDVLIRATKDYEIPLTEEEELAGHCIFRLDAPVLNQAGDKLLIGTWM
RKYDVATGERESEWDRLGTKTVVVDYPSLENPTIITSTQANGDCSGYRSNVNQLAEDGSI
YQATSRDTDGSHILRITPENEYDNTFALSLDEALGLNDVYVDAWKYVNNGIGYAMIRHGE
EDQGYIARLDLNQQTAYLVNEIPDDPDVRFNQFQGFMVSGNDLLVPVSPLGKDGNIYILH
SQTGEVSVGAKLINKPGNHFIGAF