Protein Info for Echvi_4213 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glutamate 5-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 TIGR01027: glutamate 5-kinase" amino acids 10 to 262 (253 residues), 199.9 bits, see alignment E=3.4e-63 PF00696: AA_kinase" amino acids 10 to 240 (231 residues), 129.7 bits, see alignment E=7.9e-42

Best Hits

KEGG orthology group: K00931, glutamate 5-kinase [EC: 2.7.2.11] (inferred from 58% identity to zpr:ZPR_2278)

Predicted SEED Role

"Glutamate 5-kinase (EC 2.7.2.11)" in subsystem Proline Synthesis (EC 2.7.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.11

Use Curated BLAST to search for 2.7.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2F4 at UniProt or InterPro

Protein Sequence (263 amino acids)

>Echvi_4213 Glutamate 5-kinase (Echinicola vietnamensis KMM 6221, DSM 17526)
MENLSKKPRKIVVKVGSNMLTNHKNRIMDTVLQHLVGQLAELYEDNIMPILITSGSVAAG
MEAMGRELSIKDDAVRRQIYSSMGQPRLMRHYYEIFQQYGIRCGQVLATKRDFSPGKHRE
NMINCYNGLIASGIVPIANEDDTVSLSMSAFSDNDELAALVAELLEADMLIFLTHKDGVF
NGPPDAAHTEVLEEVKIDEKTEQYIHDKGDPKTIGRGNMASKLKMAKKAASKNIAVHIAN
GTTPNVLLDIVNGKQIGTRVMAN