Protein Info for Echvi_4210 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 65 to 365 (301 residues), 119 bits, see alignment E=1.1e-38 PF25973: BSH_CzcB" amino acids 87 to 227 (141 residues), 30.5 bits, see alignment E=4.1e-11 PF25954: Beta-barrel_RND_2" amino acids 237 to 312 (76 residues), 23 bits, see alignment E=1.1e-08

Best Hits

KEGG orthology group: None (inferred from 38% identity to fbc:FB2170_10626)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G5X9 at UniProt or InterPro

Protein Sequence (387 amino acids)

>Echvi_4210 RND family efflux transporter, MFP subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MRITSKQFNAIFVLTGSLLLLACSGEKNHGDQQLDNGDSVMAPGLVSLTEEQIIANDFTL
GSFEEKSFHQSVKATGMMEVPPESRIAISPYLGGYVKELPLLTGQNVKKGETLLVLENPQ
FIQLQEDLLEAKGQLAYLESDFRRQEGLAKSKVSSEKKFRKAEADYKVMKARYEALRKKL
GVVGIDPDQLAPHNITSMVKVYAPISGTVTTIQAQRGIFLEPSDVALTLVNTEDLHLELR
VFEKDAWKIREGQQVTFRLQDNPSKEYSGTVHLVGRAVDPVERSIGLHVHFDPSIETSNW
IPGMYAEAFIRTESVQRPGLPIEAVVRAGNEHYVLLQAGTFDGRRRFVKKRVETGSTENG
FMEVKNAEDFEKNAVFLTKGAFNLIKE