Protein Info for Echvi_4205 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: RNA polymerase sigma-70 factor, Bacteroides expansion family 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 TIGR02985: RNA polymerase sigma-70 factor, Bacteroides expansion family 1" amino acids 19 to 175 (157 residues), 136.7 bits, see alignment E=8.6e-44 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 19 to 175 (157 residues), 108 bits, see alignment E=3.9e-35 PF04542: Sigma70_r2" amino acids 23 to 87 (65 residues), 49.8 bits, see alignment E=6e-17 PF07638: Sigma70_ECF" amino acids 116 to 176 (61 residues), 29.4 bits, see alignment E=1.8e-10 PF08281: Sigma70_r4_2" amino acids 119 to 171 (53 residues), 62 bits, see alignment E=8.2e-21 PF04545: Sigma70_r4" amino acids 124 to 173 (50 residues), 36.8 bits, see alignment E=5.5e-13 PF00196: GerE" amino acids 133 to 172 (40 residues), 25.7 bits, see alignment 1.8e-09

Best Hits

KEGG orthology group: None (inferred from 38% identity to osp:Odosp_3610)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G4E0 at UniProt or InterPro

Protein Sequence (185 amino acids)

>Echvi_4205 RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (Echinicola vietnamensis KMM 6221, DSM 17526)
MGQIENLTISNLKKKTEEGFDYLYHRYYKNLVNYAFTFLLDSSEAEDLVQNLFIHFWENL
ESFQLKGTLDGFFYTSVKNRCLNKLKSIDVYDKHKILYIEAMLVHLSREEEIDKNVLEEE
LLMAISNLPVQAREIIVLKYFKGQKIAEIAETLNLSENTVKTQLKRGKSKLRNEMNPKLF
SIFFL