Protein Info for Echvi_4197 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 68 (32 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 273 to 291 (19 residues), see Phobius details amino acids 297 to 314 (18 residues), see Phobius details amino acids 335 to 358 (24 residues), see Phobius details amino acids 367 to 385 (19 residues), see Phobius details amino acids 392 to 410 (19 residues), see Phobius details amino acids 415 to 435 (21 residues), see Phobius details amino acids 454 to 474 (21 residues), see Phobius details PF00939: Na_sulph_symp" amino acids 7 to 470 (464 residues), 270.7 bits, see alignment E=2.9e-84 TIGR00785: transporter, divalent anion:Na+ symporter (DASS) family" amino acids 27 to 472 (446 residues), 323.3 bits, see alignment E=1.1e-100 PF03600: CitMHS" amino acids 46 to 418 (373 residues), 196.5 bits, see alignment E=6.7e-62

Best Hits

KEGG orthology group: K14445, solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2/3/5 (inferred from 66% identity to zpr:ZPR_0364)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G2E0 at UniProt or InterPro

Protein Sequence (491 amino acids)

>Echvi_4197 anion transporter (Echinicola vietnamensis KMM 6221, DSM 17526)
MGKTFSKKWSLILGPMVFIGLILLDPPSGMSEEALKVLAVTLWMAIWWIAEAVPIAVTAL
LPIVLFPITGAVEIGITTEAYGHKYIFLYMGGFILALAIERWGLHQRIALIIISLIGSNM
NSIMLGFMLATAFLSMWISNTATAVMMLPIGMAIVNQFAKVSDIYPDNREKEVGKALMLA
IAYSASIGGFATLIGTPPNLVLAGIIEELYDVKLSFLDWMKFGFPLSMLLLIICWKYLTT
YAFDCKKVDFPGGKQEINKMLKALGKISFEEKWVLIIFALTAAAWILRSFIQRLLPGIDD
AVIALMAAITLFVLPSKSGKRKLINWEEAVKLPWGIILLFGGGMALAKGFGITGLAEWIA
GKMGQMNGMSMILMILILVAMVNFLTEITSNLATTAMILPVLAPLAMSFNAHPFMLMVPV
TVAASCAFMLPVATPPNAVVFGSGYLKIPDMVKAGFWMNIFSILLVTIVSYYLLDAFWNF
EADVFSKVLIT