Protein Info for Echvi_4184 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted transcriptional regulators

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 transmembrane" amino acids 58 to 72 (15 residues), see Phobius details PF13560: HTH_31" amino acids 19 to 76 (58 residues), 36.5 bits, see alignment E=1e-12 PF12844: HTH_19" amino acids 20 to 76 (57 residues), 33 bits, see alignment E=9.3e-12 PF01381: HTH_3" amino acids 23 to 75 (53 residues), 39.7 bits, see alignment E=8e-14 PF13443: HTH_26" amino acids 29 to 71 (43 residues), 23.4 bits, see alignment E=1.2e-08

Best Hits

KEGG orthology group: None (inferred from 63% identity to cao:Celal_0408)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G4C0 at UniProt or InterPro

Protein Sequence (105 amino acids)

>Echvi_4184 Predicted transcriptional regulators (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKSNIILLPKNKKLLAVLGENIKLARLRRKLTMQQVSERAGISRPTLSSLESGNPTVSL
GIVLQVLLVLGLEKDLLSIANDDLLGRKIQDADLTLKQRGPKTGE