Protein Info for Echvi_4157 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Molybdopterin converting factor, large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 PF02391: MoaE" amino acids 24 to 128 (105 residues), 101.4 bits, see alignment E=1.8e-33

Best Hits

KEGG orthology group: K03635, molybdopterin synthase catalytic subunit [EC: 2.-.-.-] (inferred from 66% identity to shg:Sph21_0143)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaE" in subsystem Molybdenum cofactor biosynthesis

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G5S4 at UniProt or InterPro

Protein Sequence (148 amino acids)

>Echvi_4157 Molybdopterin converting factor, large subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MEKANNIKDIFVNGAIPPDKIAKSIANHGVKTAIGAHSIFLGQIRTDENNGRKVVAIEYT
AYRDMALEKAREIREETFSKYDLTCLHIYHSLGEVNVGEICLFVFTSSPHRKAAIAACNE
LVERIKSELPIWGKEVFDDNSEQWKVNQ