Protein Info for Echvi_4147 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Methylase involved in ubiquinone/menaquinone biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 PF13489: Methyltransf_23" amino acids 41 to 153 (113 residues), 28.1 bits, see alignment E=5.7e-10 PF01209: Ubie_methyltran" amino acids 43 to 152 (110 residues), 25.5 bits, see alignment E=2.7e-09 PF13847: Methyltransf_31" amino acids 43 to 156 (114 residues), 39.1 bits, see alignment E=2.2e-13 PF05401: NodS" amino acids 45 to 152 (108 residues), 29.9 bits, see alignment E=1.7e-10 PF13649: Methyltransf_25" amino acids 47 to 142 (96 residues), 49.3 bits, see alignment E=2.4e-16 PF08242: Methyltransf_12" amino acids 48 to 144 (97 residues), 45 bits, see alignment E=5.2e-15 PF08241: Methyltransf_11" amino acids 48 to 145 (98 residues), 48.5 bits, see alignment E=4e-16

Best Hits

KEGG orthology group: None (inferred from 62% identity to fjo:Fjoh_2989)

Predicted SEED Role

"SAM-dependent methyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G4U7 at UniProt or InterPro

Protein Sequence (211 amino acids)

>Echvi_4147 Methylase involved in ubiquinone/menaquinone biosynthesis (Echinicola vietnamensis KMM 6221, DSM 17526)
MGSFDRQKHWENIYQSKRLEEVSWYQPTPKTSLSFLKQFNIPKHAKIIDVGGGDSLLVDH
LIDLGYLNITVLDISESALKRARQRLGNRANKVKWIVADAETFVATEQYDFWHDRAAFHF
LTEEQEIETYLENAQRSIKPEGILMLGTFSEEGPQKCSGIKIKQYSESTMTALLQRFFEK
LKCKSVNHKTPFETIQQFTFCSFRKLQIDLI