Protein Info for Echvi_4116 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF16576: HlyD_D23" amino acids 81 to 315 (235 residues), 110.6 bits, see alignment E=1e-35 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 92 to 389 (298 residues), 136.5 bits, see alignment E=4.9e-44 PF13533: Biotin_lipoyl_2" amino acids 98 to 141 (44 residues), 23.8 bits, see alignment 4.7e-09 PF13437: HlyD_3" amino acids 213 to 313 (101 residues), 53.4 bits, see alignment E=5.5e-18

Best Hits

KEGG orthology group: None (inferred from 67% identity to gfo:GFO_1187)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G4R5 at UniProt or InterPro

Protein Sequence (410 amino acids)

>Echvi_4116 RND family efflux transporter, MFP subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MKNQLIYILALLMIASVFTGCGSKSADTAKETHENHAEGEGGHEGGESSHSEEEVGVVHL
SDLKFNSLKMKVDSLPMRALSGVVEANGQLEVPPQHEATVTAILGANVTSIKVIEGEKVN
KGQALAYLSHPNLTQLQTNYVKSFSRLQYLEKEMQRQKRLYEEEVGSGKTYQETLADFQA
MKGEVKGYEAQLKQLNLNISKIQNGDIYQYVPVVSPINGYIEKVLVQVGQFADPQKEMFM
IVNTEHIHADLMVFEKDVHKVKEGQKVSFRVESVPGEQLEAEIYSVGKQFEQNPKAVHVH
AEIESKEDFLIPGMYINGKIHTESESVKALPEGAIVEDEGKPYIFIAEAHEEDGKTEWAF
QPVEVRTGISDEGWVEINLLEPLPEGTKVAWNNAYYLIAEMKKSQTSHSH