Protein Info for Echvi_4108 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Co/Zn/Cd efflux system component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 86 to 108 (23 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 218 to 235 (18 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details PF01545: Cation_efflux" amino acids 88 to 260 (173 residues), 64.2 bits, see alignment E=7.3e-22

Best Hits

KEGG orthology group: None (inferred from 81% identity to mtt:Ftrac_2056)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G5M3 at UniProt or InterPro

Protein Sequence (263 amino acids)

>Echvi_4108 Co/Zn/Cd efflux system component (Echinicola vietnamensis KMM 6221, DSM 17526)
MNKSIFKIAKMDCPSEEQMVRMKLEPLSQVKHLEFDIPARRLEVFHQDEVQPIHKAINEL
NLNGQLEGTTNAELPIEVDDSHQRKILWWVLGINFGFFVAEMTTGWISRSMGLIADSLDM
LADSIVYGLSLFAVGAAISRKKKVAKISGYFQMALALLGFSEVLRRFFTQSETPLFQWMI
IVSLLALAGNLISLWLINKAKSKEAHMQASAIFTSNDIIVNAGVILAGVLVYWLESKWPD
LIVGGIVFAFVMRGAIRILRLAK