Protein Info for Echvi_4074 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Tetratricopeptide repeat.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF14559: TPR_19" amino acids 59 to 122 (64 residues), 30.4 bits, see alignment E=3.7e-10 amino acids 93 to 150 (58 residues), 32.7 bits, see alignment 7.5e-11 amino acids 193 to 253 (61 residues), 33.3 bits, see alignment E=4.9e-11 PF13174: TPR_6" amino acids 118 to 143 (26 residues), 12.9 bits, see alignment (E = 0.00014) PF13432: TPR_16" amino acids 120 to 174 (55 residues), 18.9 bits, see alignment 1.7e-06 amino acids 191 to 250 (60 residues), 22 bits, see alignment 1.7e-07 PF13429: TPR_15" amino acids 315 to 486 (172 residues), 28.4 bits, see alignment E=1.1e-09 PF13181: TPR_8" amino acids 434 to 464 (31 residues), 22.7 bits, see alignment (E = 7.2e-08) amino acids 506 to 531 (26 residues), 17.5 bits, see alignment (E = 3.5e-06)

Best Hits

Predicted SEED Role

"FIG00898077: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G5I5 at UniProt or InterPro

Protein Sequence (582 amino acids)

>Echvi_4074 Tetratricopeptide repeat. (Echinicola vietnamensis KMM 6221, DSM 17526)
MQIKTFKQSLLFLAIALPLVFSAPSAHAQFNIFKGAKKEQKEADMATRLFIEGEKHMMLE
DYEKAYFYFDKAHDLTPESGAVNFKMAEILARANQNEKALEHGQKAVEADPENKYYHLLI
AEVYTKQNQPEKAAEILETLIESSDDNKQYILELASLYLSTQQFDKALIALDKAEEYYGV
VEQLSVQKQRIYLKQNNLDAAIKEGEKLIQANPGNSRYVLALVEMLFNNNRIDQALGVVN
ASLEDYPNQPDLHLAAYTLYKKKEALDVAHDHLFTAFQSPDLEGEIKAQTFGDIMQKDLK
TKERESMLDSLETLMVKTSPKSAPVWTILGDRAMQNQQPAKALENYQQSIAINPQDPKVL
QGVISLMFEQGKDFEEIETYTALGTEEFPQKPEFWFFDGTAKLAIKKHEAAATSLKQSLE
LNDGTNKQLDLMVLGQLGDTYHALKKEDKAFEAYDKVLEISPEDEHVLNNYAYFLSLEKR
DLDKALDMSSKLVRRFPDNATYLDTHAWVLFQKKSYQEAEKYMKKALELEESPSGVMLEH
YGDILFHLGDKSGALEYWEKAAGKSDVSEELDQKIKDKKYYE