Protein Info for Echvi_4069 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Enoyl-CoA hydratase/carnithine racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 11 to 260 (250 residues), 223.7 bits, E=2.5e-70
• PF16113: ECH_2
  • amino acids 17 to 189 (173 residues), 131.3 bits, E=5.9e-42

Best Hits

Swiss-Prot: 48% identical to CRT_CLOAB: Short-chain-enoyl-CoA hydratase (crt) from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)

KEGG orthology group: K01715, 3-hydroxybutyryl-CoA dehydratase [EC: 4.2.1.55] (inferred from 67% identity to mtt:Ftrac_3324)

MetaCyc: 48% identical to crotonase monomer (Clostridium acetobutylicum)
Long-chain-enoyl-CoA hydratase. [EC: 4.2.1.74]; RXN-11667 [EC: 4.2.1.74, 4.2.1.150]

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

• oleate β-oxidation (27/35 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• fatty acid salvage (5/6 steps found)
• pyruvate fermentation to butanol II (engineered) (5/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• glycerol degradation to butanol (12/16 steps found)
• adipate degradation (4/5 steps found)
• fatty acid β-oxidation II (plant peroxisome) (4/5 steps found)
• pyruvate fermentation to butanol I (6/8 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (10/14 steps found)
• L-isoleucine degradation I (4/6 steps found)
• methyl ketone biosynthesis (engineered) (4/6 steps found)
• valproate β-oxidation (6/9 steps found)
• adipate biosynthesis (3/5 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• (2S)-ethylmalonyl-CoA biosynthesis (2/4 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
• pyruvate fermentation to butanoate (4/7 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• propanoate fermentation to 2-methylbutanoate (3/6 steps found)
• acetyl-CoA fermentation to butanoate (3/7 steps found)
• fatty acid β-oxidation I (generic) (3/7 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (4/9 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (1/5 steps found)
• L-valine degradation I (3/8 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (5/11 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
• benzoyl-CoA degradation I (aerobic) (2/7 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
• L-tryptophan degradation III (eukaryotic) (7/15 steps found)
• 3-phenylpropanoate degradation (3/10 steps found)
• phenylacetate degradation I (aerobic) (2/9 steps found)
• L-glutamate degradation VII (to butanoate) (4/12 steps found)
• ethylmalonyl-CoA pathway (3/11 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
• gallate degradation III (anaerobic) (2/11 steps found)
• superpathway of phenylethylamine degradation (2/11 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (3/13 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (3/14 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (3/17 steps found)
• toluene degradation VI (anaerobic) (3/18 steps found)
• platensimycin biosynthesis (6/26 steps found)
• Spodoptera littoralis pheromone biosynthesis (3/22 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.150 or 4.2.1.17 or 4.2.1.55 or 4.2.1.74

Sequence Analysis Tools

See L0G5I1 at UniProt or InterPro

Protein Sequence (261 amino acids)

>Echvi_4069 Enoyl-CoA hydratase/carnithine racemase (Echinicola vietnamensis KMM 6221, DSM 17526)
MAESTNILSENKDGILYLTINRESKLNAINFDTLEELKNIFNEVSDNKSIRGVVLTGSGE
KAFVAGADISEIAELNELNARKFSENGQEVFSLIESCHKPVIAVVNGFALGGGCELSMAC
HMRIATSNAKFGQPEVNLGIIPGYGGTQRLTFLIGRTKANELLMTGDMVDAAEAKALGLV
NYVTQTKAEAIQKAEEILQKIMTKAPLSIGMIIDCVNAVYSNDENGYLIEANSFARCVKS
EDYSEGTSAFLEKRKPNFKGE