Protein Info for Echvi_4063 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: GTP-binding protein TypA/BipA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 601 TIGR00231: small GTP-binding protein domain" amino acids 3 to 141 (139 residues), 75.9 bits, see alignment E=3.1e-25 PF00009: GTP_EFTU" amino acids 3 to 194 (192 residues), 184.9 bits, see alignment E=2.9e-58 TIGR01394: GTP-binding protein TypA/BipA" amino acids 4 to 595 (592 residues), 899.6 bits, see alignment E=7.7e-275 PF03144: GTP_EFTU_D2" amino acids 217 to 287 (71 residues), 50.7 bits, see alignment E=5.1e-17 PF00679: EFG_C" amino acids 396 to 476 (81 residues), 73.5 bits, see alignment E=2.9e-24 PF21018: BipA_C" amino acids 481 to 589 (109 residues), 154.4 bits, see alignment E=2.1e-49

Best Hits

Swiss-Prot: 52% identical to TYPA_BACSU: GTP-binding protein TypA/BipA homolog (typA) from Bacillus subtilis (strain 168)

KEGG orthology group: K06207, GTP-binding protein (inferred from 82% identity to dfe:Dfer_3399)

Predicted SEED Role

"GTP-binding protein TypA/BipA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G5Z9 at UniProt or InterPro

Protein Sequence (601 amino acids)

>Echvi_4063 GTP-binding protein TypA/BipA (Echinicola vietnamensis KMM 6221, DSM 17526)
MQNIRNIAIIAHVDHGKTTLVDKIIHASKIFRENQQFDDLILDNNDLERERGITILSKNV
SVRYKDIKINIIDTPGHADFGGEVERVLKMADGVILLVDAFEGPMPQTRFVLSKALGLGL
TPIVVVNKVDKPNCRPDEVHEAVFDLMFNLDATEEQLDFVTMYGSAKNNWMGPDWKNPTD
SILPLLDTIIEHIPAPTIQEGSTQMQITSLDFSNFVGRIAIGRLKRGTLKENTQIALCKA
DGSIKKMRIKELHVFEGLGKNKVEEVHAGDICAVTGIEGFEIGDTIADAENPEPLPRIAI
DEPTMNMLFTINNSPFFGKEGKFVTSRHLRDRLFKEMEKNLALRVEPTDNEDKFLVYGRG
ILHLSVLIETMRREGYELQVGQPQVIYKDIDGVKNEPIESLVVDVPEETAGKVIELATQR
KGELLVMEPRGDLQHLEFRIPSRGLIGLRNNVLTATQGEAIMNHRFVDYEPFKGPIPGRI
NGSLISMESGPTTGYAIDKLQDRGTFFVDPGEEIYGGQVIGEHSRDNDIVVNVQKGKKLT
NMRASGSDDNTKIPPAKKFSLEEAMEYIQKDEYLEITPKSMRMRKIYLDEGERNRMAKKD
A