Protein Info for Echvi_4031 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: glycerate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00045: glycerate kinase
  • amino acids 3 to 322 (320 residues), 259.1 bits, E=3.3e-81
• PF02595: Gly_kinase
  • amino acids 3 to 360 (358 residues), 309.8 bits, E=1.2e-96

Predicted SEED Role

"Glycerate kinase (EC 2.7.1.31)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Glycine and Serine Utilization or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle (EC 2.7.1.31)

MetaCyc Pathways

• photorespiration I (4/9 steps found)
• photorespiration III (4/9 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycine, serine and threonine metabolism
• Glyoxylate and dicarboxylate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.31

Sequence Analysis Tools

See L0G4J4 at UniProt or InterPro

Protein Sequence (370 amino acids)

>Echvi_4031 glycerate kinase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNILIAPNAFKGTIPADRAAALIEEVLRQYLSHAEYQRCPIADGGDGTCFLLGNQLKLNK
IEAVGLNAIGLTEQGLIFLNESRKEAWIDVSTLSGLAGLPPFGVNAQLTSTFGTGQLIME
AIRRGAEHIILGLGGSATVDMGTGILRALGYLFLDKNGREIPMFSPGFLERIAHIQRPVA
MNKVRFTCLCDVKNTFFGSQGAIPVFGPQKGLSEADQHVFESAAKGVFELLKAKGDGQLT
DQPGFGAAGGIALGLSAFFSVKIEEGAHYFFEQVNMQEKVSWADWVITGEGKFDSQSAAG
KGSYKLLGLANKHQKKTLLITSGGEKDGKEAGFDDVVQLPKLNMDDLDFKQKAAENLKSS
LQFFLEKSNI