Protein Info for Echvi_4019 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: oxygen-independent coproporphyrinogen III oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 TIGR00538: oxygen-independent coproporphyrinogen III oxidase" amino acids 2 to 448 (447 residues), 402.5 bits, see alignment E=1.2e-124 PF04055: Radical_SAM" amino acids 56 to 229 (174 residues), 64.1 bits, see alignment E=9e-22

Best Hits

KEGG orthology group: K02495, oxygen-independent coproporphyrinogen III oxidase [EC: 1.3.99.22] (inferred from 51% identity to cpi:Cpin_0687)

Predicted SEED Role

"Coproporphyrinogen III oxidase, oxygen-independent (EC 1.3.99.22)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.99.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.22

Use Curated BLAST to search for 1.3.99.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G5D1 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Echvi_4019 oxygen-independent coproporphyrinogen III oxidase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKISADLIAKYDVAVPRYTSYPTVPLWENNVDAPTWKNNVLKAYQQFGQKEGISLYIHLP
YCDSLCTYCGCNKYITRNHEKEVPYLEALKREWDMYLQMLPARPKLATIHLGGGTPTFFS
ADNLRSLIKYICGTSDVVPKAKFSFEGHPNNTTLEHLLTLKEVGFERVSYGIQDLNLKVQ
QAIHRIQPLSTVREATYHAQLAGFSQINFDLIYGLPHQTEETIETTLDEISKLMPSRIAF
YSYAHVPSVFQAQKSFEQHLPLKSAKRKLYETGKRKLMAMGYEEIGMDHFALPGDELLTA
KATGKLHRNFMGYTNFSSHMLIGLGSSAISDVYYAYAQNTKNIELYEEQSMLGHFSHSKG
HLMTTEDIKTRKTILDLICTGTTEEASIIWKMDNLKLLNELQEDGLLSMRENRIIVTPLG
RAFIRNICSAFDHRMKSKKSQTFVFSKAI