Protein Info for Echvi_4009 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: TQO small subunit DoxD./TQO small subunit DoxA.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details PF04173: DoxD" amino acids 15 to 159 (145 residues), 180.2 bits, see alignment E=3.3e-57 PF07680: DoxA" amino acids 205 to 334 (130 residues), 175.7 bits, see alignment E=4.1e-56

Best Hits

KEGG orthology group: None (inferred from 56% identity to bth:BT_0515)

Predicted SEED Role

"Terminal quinol oxidase, subunit, putative (doxD-like)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G5C2 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Echvi_4009 TQO small subunit DoxD./TQO small subunit DoxA. (Echinicola vietnamensis KMM 6221, DSM 17526)
MLKTNIKHDAGLMSLALRLVVGWTYFSALYRRTILADKLDPEISGYIGEKFNHFLPHALG
IKPIIQYLVTHPDLLWWAMVTFTIVEGIVGFMIMMGAFTRLMSVGVFGLAMGILLGSGWI
GTTCLDEWQIGVLGIAAGFVLFLTGSGKYSMDHYVLQQQLPFTRKRWFPWVASGELPVKA
GHYPKLVLAGSLAILGITLMTNQVFHGGLWGPLHNKSVKPKLEISAGKFTQKGLEFDVFR
TEGVDVYGAWIIGMEIKNDTGKEIYALSNKAMSNMDPSAITNHYVAKVKPGKHSLVVPLG
AKATIALRAPALEGIERGSYTLKITDISGASWKYRMRKE