Protein Info for Echvi_4005 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 10 to 200 (191 residues), 188.2 bits, E=1.8e-59
• PF08659: KR
  • amino acids 12 to 165 (154 residues), 51.4 bits, E=2e-17
• PF13561: adh_short_C2
  • amino acids 16 to 251 (236 residues), 198.5 bits, E=2e-62

Best Hits

Swiss-Prot: 46% identical to IDNO_ECOL6: 5-keto-D-gluconate 5-reductase (idnO) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00046, gluconate 5-dehydrogenase [EC: 1.1.1.69] (inferred from 68% identity to fjo:Fjoh_4263)

MetaCyc: 58% identical to 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase monomer (Streptococcus agalactiae NEM316)
2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase. [EC: 1.1.1.127]

Predicted SEED Role

"2-deoxy-D-gluconate 3-dehydrogenase (EC 1.1.1.125)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 1.1.1.125)

MetaCyc Pathways

• 4-deoxy-L-threo-hex-4-enopyranuronate degradation (4/5 steps found)
• 2-deoxy-D-glucose 6-phosphate degradation (2/4 steps found)
• 3,6-anhydro-α-L-galactopyranose degradation (4/7 steps found)
• L-idonate degradation (1/3 steps found)
• ketogluconate metabolism (1/8 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (14/31 steps found)

KEGG Metabolic Maps

• Pentose and glucuronate interconversions

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.125 or 1.1.1.127 or 1.1.1.69

Sequence Analysis Tools

See L0G3V3 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Echvi_4005 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) (Echinicola vietnamensis KMM 6221, DSM 17526)
MKELFDLSGKVALVTGATHGLGMAMAKALAKSGATLIVNGHTPAKMEKALEEYAADGIEA
HGYLFDVTNEKEVDEKLSEIEGKFGTVDILVNNAGMIQRTPAMEMEVADFAKVVNMDLVS
PFLMSKRVAKGMKEKGGGKIINICSMMSELGRNTVSGYAAAKGGLKMLTRNLATEWAKYN
IQVNGIGPGYFATEQTAPIRVDGHPFNDFIINRTPAGRWGDPEDLQGTMVFLASQASNFV
NGQIVYVDGGILASIGKPHGEE