Protein Info for Echvi_3949 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: polyphosphate:nucleotide phosphotransferase, PPK2 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 TIGR03709: polyphosphate:nucleotide phosphotransferase, PPK2 family" amino acids 12 to 280 (269 residues), 323.1 bits, see alignment E=5.8e-101 PF03976: PPK2" amino acids 29 to 267 (239 residues), 202.8 bits, see alignment E=3e-64

Best Hits

KEGG orthology group: None (inferred from 68% identity to cly:Celly_0138)

Predicted SEED Role

"Bll6474 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1S5 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Echvi_3949 polyphosphate:nucleotide phosphotransferase, PPK2 family (Echinicola vietnamensis KMM 6221, DSM 17526)
MDKIKTSYYRVDAPIRLKDVPTLTNLNASDDQLKDRLSDIRRKIGKLQDVLYAHGKYSVL
VCFQGMDTAGKDSLIREVFKDFNSRGVVVHSFKTPTSIQKKQDYLWRHYIALPARGKFGV
FNRSHYENVLVTRVHPEYILGEHLPGVDSVEDITDAFWHERFEQIKAFERHLAQNGTIIF
KFFLHLSKEEQKNRLLRRLRLEEKNWKFSPDDLKERTLWDKYQQYYEEAINITSTDHAPW
YIIPADNKKAARTIVADIMYDELKERKDIKYPVLGEEVRAKLDVYKKQLHHE