Protein Info for Echvi_3924 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: RNA polymerase sigma-70 factor, Bacteroides expansion family 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 19 to 173 (155 residues), 98.7 bits, see alignment E=2.8e-32 TIGR02985: RNA polymerase sigma-70 factor, Bacteroides expansion family 1" amino acids 19 to 173 (155 residues), 151.3 bits, see alignment E=2.8e-48 PF04542: Sigma70_r2" amino acids 24 to 88 (65 residues), 45.5 bits, see alignment E=1.3e-15 PF07638: Sigma70_ECF" amino acids 108 to 173 (66 residues), 30.9 bits, see alignment E=6.4e-11 PF08281: Sigma70_r4_2" amino acids 121 to 169 (49 residues), 61.1 bits, see alignment E=1.6e-20 PF04545: Sigma70_r4" amino acids 125 to 172 (48 residues), 38.1 bits, see alignment E=2.3e-13 PF00196: GerE" amino acids 128 to 166 (39 residues), 34 bits, see alignment 4.6e-12

Best Hits

KEGG orthology group: None (inferred from 30% identity to phe:Phep_1381)

Predicted SEED Role

"RNA polymerase ECF-type sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G1Q5 at UniProt or InterPro

Protein Sequence (191 amino acids)

>Echvi_3924 RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (Echinicola vietnamensis KMM 6221, DSM 17526)
MHTDLSEIAFRIKQSDKSAFHEFYQLFHKRIYFFCIHYGLKSSDAEEITQDVFVKFWCSR
KNIDPEKCIKAYLFMISKNTILDMLRKSIRSKANKTYQMNLILPVNNTENTLEYNELMGI
VEKTLTALPERRRQVFEMSRLQGMSHKEIASNLNISTKTVENHLTLALQNFRQVFQDAKI
MSTSLLAFFLT