Protein Info for Echvi_3907 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Mannose-6-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01050: MannoseP_isomer
  • amino acids 69 to 165 (97 residues), 26.3 bits, E=3.3e-10

Best Hits

KEGG orthology group: None (inferred from 62% identity to dfe:Dfer_3304)

Predicted SEED Role

"Mannose-1-phosphate guanylyltransferase (GDP) (EC 2.7.7.22) / Mannose-6-phosphate isomerase (EC 5.3.1.8)" in subsystem Alginate metabolism or Mannose Metabolism (EC 2.7.7.22, EC 5.3.1.8)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• GDP-mannose biosynthesis (3/4 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (2/3 steps found)
• D-mannose degradation I (1/2 steps found)
• D-mannose degradation II (1/2 steps found)
• mannitol degradation II (2/4 steps found)
• mannitol biosynthesis (1/3 steps found)
• 1,5-anhydrofructose degradation (2/5 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (8/14 steps found)
• β-(1,4)-mannan degradation (2/7 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.22

Use Curated BLAST to search for 2.7.7.22 or 5.3.1.8

Sequence Analysis Tools

See L0G3M5 at UniProt or InterPro

Protein Sequence (170 amino acids)

>Echvi_3907 Mannose-6-phosphate isomerase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKIEKSASKEAIFKQIKDWLDFNGYEVAAEDRERPWGGFFVIEESQIAKFRSQFFASVEF
SEEQLKQKLSPKILIVGPEKRLSWQYHHRRAEIWKLVGGEGGIVTSPTDEEGELQPLVLG
EVVELAKGERHRLVGMDNWGVVAEIWMHTDPSNPSNEEDIVRVQDDFQRK