Protein Info for Echvi_3864 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF13477: Glyco_trans_4_2" amino acids 21 to 143 (123 residues), 60.1 bits, see alignment E=8.6e-20 PF13579: Glyco_trans_4_4" amino acids 22 to 171 (150 residues), 68.1 bits, see alignment E=3.5e-22 PF13439: Glyco_transf_4" amino acids 23 to 171 (149 residues), 58.5 bits, see alignment E=2.7e-19 PF20706: GT4-conflict" amino acids 195 to 357 (163 residues), 39.4 bits, see alignment E=1.2e-13 PF00534: Glycos_transf_1" amino acids 202 to 347 (146 residues), 92.9 bits, see alignment E=5.3e-30 PF13692: Glyco_trans_1_4" amino acids 206 to 339 (134 residues), 82.9 bits, see alignment E=8.3e-27

Best Hits

Predicted SEED Role

"Alpha-1,3-N-acetylgalactosamine transferase PglA (EC 2.4.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G502 at UniProt or InterPro

Protein Sequence (384 amino acids)

>Echvi_3864 Glycosyltransferase (Echinicola vietnamensis KMM 6221, DSM 17526)
MPKLIRITTVPLSLKLLLSGQMKYMKAAGWDVQMVSADGKEVNEVTAKEGCEHHSIPFTR
QITPLQDLVCLWKLYQFLKVEQPDIVHTHTPKAGLLGMIAAKLAGIKIRIHTVAGLPYVV
TKDNKRKMLENAERWTFKYATHVWPNAHSLKAFIEKEQLARPEKLEVLGNGSSNGVDIAR
FSRENLKENHLVAATMRVMPGESDFIILAVGRLVKDKGIQELVEAFLKSRIVNKSKLVLL
GDYEQHLDPLDEDIVRKIADHPRIVQVSWSDHVEHYMAISDVLVHASHREGFPNVILEAG
AMQVPVICSDIPGSSDLVQNKKTGLVFPVKSVSVLKDALEFAFVKRESMQLLADALHKEV
VAHFDRKKMHALLLEKYQSLMEKK