Protein Info for Echvi_3852 in Echinicola vietnamensis KMM 6221, DSM 17526

Updated annotation (from data): arginosuccinate lyase (EC 4.3.2.1)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR00838.
Original annotation: argininosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00838: argininosuccinate lyase
  • amino acids 11 to 388 (378 residues), 335.8 bits, E=2.3e-104
• PF00206: Lyase_1
  • amino acids 25 to 300 (276 residues), 160.5 bits, E=3.5e-51

Best Hits

Swiss-Prot: 60% identical to ARLY_BACFN: Argininosuccinate lyase (argH) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K01755, argininosuccinate lyase [EC: 4.3.2.1] (inferred from 66% identity to mtt:Ftrac_1535)

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• urea cycle (4/5 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• superpathway of arginine and polyamine biosynthesis (12/17 steps found)
• canavanine biosynthesis (2/4 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.1

Sequence Analysis Tools

See L0G1J8 at UniProt or InterPro

Protein Sequence (444 amino acids)

>Echvi_3852 arginosuccinate lyase (EC 4.3.2.1) (Echinicola vietnamensis KMM 6221, DSM 17526)
MKLWQKNTTSTKEVEQFTIGRDPEFDIVLAPFDVLGSLAHATMLESIDLLTKEELAILKK
GLKDIYQEIQEGTFTIDPGVEDVHSQVEFLLTERYGDVGKKLHSGRSRNDQVAVDLKLYY
RAVIQEVLDDAKALFDLLLTLAEKHQNDLMPGYTHTQLAMPSSFGLWFGAMAESLAEDME
LWLAAYNLADRNPLGSAAGYGSSFPLNRTMTTRLLGFKDMHYNVINAQNNRGKTEKAIAF
AMAGMAGTLNRLSADIIIFMNQHFGFVKFPDNLTTGSSIMPHKKNPDVFELIRAKANQIQ
SGPQNLMMQMTNTTTGYHRDLQLLKETTFPDFEKLKDCLQITKFMLEHIEIKPDILEDKF
YKHLFSVEVVNDLVLQGMPFRDAYKKVGLDIESDDFAPDHTVNHSHEGSIGQLCLDEIRT
KMETALAKFDFSAIETSYQKLLEA