Protein Info for Echvi_3846 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: argininosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF03054: tRNA_Me_trans" amino acids 2 to 117 (116 residues), 23.9 bits, see alignment E=6e-09 PF00764: Arginosuc_synth" amino acids 3 to 165 (163 residues), 145.9 bits, see alignment E=2.3e-46 TIGR00032: argininosuccinate synthase" amino acids 3 to 392 (390 residues), 271.9 bits, see alignment E=5.8e-85 PF06508: QueC" amino acids 3 to 117 (115 residues), 25 bits, see alignment E=2.4e-09 PF20979: Arginosuc_syn_C" amino acids 173 to 389 (217 residues), 114 bits, see alignment E=1.6e-36

Best Hits

Swiss-Prot: 32% identical to ASSY_PARL1: Argininosuccinate synthase (argG) from Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 76% identity to mtt:Ftrac_1530)

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G439 at UniProt or InterPro

Protein Sequence (399 amino acids)

>Echvi_3846 argininosuccinate synthase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKVVLAYSGGLDTTFCAIHLSQEKGYEVHAVLVNTGGFSEEELKTTEERAGKLGIASFK
VLDVTQTYYNEVIKYLIFGNVLKNQTYPLSVSAERILQAKALAEYAKQIGAKAVAHGSTG
AGNDQVRFDMIFQTILPEAEIITPIRDLQLSREAEIEFLKKHGVEMNFEKAKYSINKGIW
GTSVGGKETLTSGDTLPEEAYPTQLTKETPTQISLQFEAGELVGVNGQKFSNPVDAILKV
QALADPYAIGRDIHVGDTIIGIKGRVGFEAAAPLIIIKAHQLLEKHTLTKWQTFWKNQLS
EFYGNHLHEGHYLDPVMRNLEAFLADTQQFVSGEVKVALKPYQFQLIGIDSPHDLMSAKF
GSYGEMNKGYTAEDVKGFTKILGNQTAIYHKVNQTLDND