Protein Info for Echvi_3846 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: argininosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03054: tRNA_Me_trans
  • amino acids 2 to 117 (116 residues), 23.9 bits, E=6e-09
• PF06508: QueC
  • amino acids 3 to 117 (115 residues), 24.9 bits, E=2.7e-09
• TIGR00032: argininosuccinate synthase
  • amino acids 3 to 392 (390 residues), 271.9 bits, E=5.8e-85
• PF00764: Arginosuc_synth
  • amino acids 3 to 165 (163 residues), 145.9 bits, E=2.3e-46
• PF20979: Arginosuc_syn_C
  • amino acids 173 to 389 (217 residues), 114 bits, E=1.6e-36

Best Hits

Swiss-Prot: 32% identical to ASSY_PARL1: Argininosuccinate synthase (argG) from Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 76% identity to mtt:Ftrac_1530)

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• urea cycle (4/5 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• superpathway of arginine and polyamine biosynthesis (12/17 steps found)
• canavanine biosynthesis (2/4 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Sequence Analysis Tools

See L0G439 at UniProt or InterPro

Protein Sequence (399 amino acids)

>Echvi_3846 argininosuccinate synthase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKVVLAYSGGLDTTFCAIHLSQEKGYEVHAVLVNTGGFSEEELKTTEERAGKLGIASFK
VLDVTQTYYNEVIKYLIFGNVLKNQTYPLSVSAERILQAKALAEYAKQIGAKAVAHGSTG
AGNDQVRFDMIFQTILPEAEIITPIRDLQLSREAEIEFLKKHGVEMNFEKAKYSINKGIW
GTSVGGKETLTSGDTLPEEAYPTQLTKETPTQISLQFEAGELVGVNGQKFSNPVDAILKV
QALADPYAIGRDIHVGDTIIGIKGRVGFEAAAPLIIIKAHQLLEKHTLTKWQTFWKNQLS
EFYGNHLHEGHYLDPVMRNLEAFLADTQQFVSGEVKVALKPYQFQLIGIDSPHDLMSAKF
GSYGEMNKGYTAEDVKGFTKILGNQTAIYHKVNQTLDND