Protein Info for Echvi_3845 in Echinicola vietnamensis KMM 6221, DSM 17526
Updated annotation (from data): N-succinylglutamate synthase
Rationale: This gene is in an operon with and conserved cofit with other arginine synthesis genes. The traditional synthase (argA) is not present. This protein is 63% identical to Cabys_1732 which is reported to be a N-acetylglutamate synthase (PMID:28265262). However, Bacteroidetes are thought to use succinylated intermediates for arginine synthesis (see PMID:32576650)
Original annotation: N-acetylglutamate synthase and related acetyltransferases
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 67% identity to psn:Pedsa_3186)Predicted SEED Role
"FIG00651573: hypothetical protein"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0G3H4 at UniProt or InterPro
Protein Sequence (224 amino acids)
>Echvi_3845 N-succinylglutamate synthase (Echinicola vietnamensis KMM 6221, DSM 17526) MTKSQFIIQTAGVQHCKYAETIVDEMALSAKARGTGIAKRSPDYIIQKMMEGKAVIALSK EGEWAGFCYIEAWGHGKFVANSGLIVSPNFRKSGLAREIKKAVFKLSRSKFPHAKIFGLT TGAAVMKINSELGYVPVSYSDLTDDEEFWKGCQSCVNYEILKSKNRQNCLCTAMLYVPKD QKKKEVAMKKDFGKNLNLFERLVRMKRAVFTGIKKKTIKTFELI