Protein Info for Echvi_3829 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Cytosine/adenosine deaminases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF00383: dCMP_cyt_deam_1" amino acids 5 to 103 (99 residues), 97.7 bits, see alignment E=3.3e-32 PF14437: MafB19-deam" amino acids 6 to 106 (101 residues), 74.6 bits, see alignment E=7.3e-25

Best Hits

Swiss-Prot: 61% identical to GUAD_BACSU: Guanine deaminase (guaD) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 63% identity to cly:Celly_2898)

Predicted SEED Role

"Guanine deaminase (EC 3.5.4.3)" in subsystem Purine Utilization or Purine conversions (EC 3.5.4.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G4X0 at UniProt or InterPro

Protein Sequence (158 amino acids)

>Echvi_3829 Cytosine/adenosine deaminases (Echinicola vietnamensis KMM 6221, DSM 17526)
MEALQKTFMEMAIRLSREGMTSGKGGPFGCVIVKDGVVIGKGNNQVLSTNDPTAHAEVVA
IREACKTLRSFQLEGCEIYTSCEPCPMCLGAIYWARPAKVFYANTRHEAADAGFDDDFIY
QELPLPPAQRKISMVHAPDKAALEVFREWIDKEDKNVY