Protein Info for Echvi_3826 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Outer membrane receptor proteins, mostly Fe transport

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 847 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 44 to 119 (76 residues), 53.6 bits, see alignment E=6.1e-18 PF13715: CarbopepD_reg_2" amino acids 45 to 140 (96 residues), 43.9 bits, see alignment E=5e-15 PF07715: Plug" amino acids 153 to 244 (92 residues), 38.9 bits, see alignment E=2.7e-13 PF00593: TonB_dep_Rec_b-barrel" amino acids 336 to 775 (440 residues), 57 bits, see alignment E=8.6e-19 PF14905: OMP_b-brl_3" amino acids 400 to 811 (412 residues), 326.8 bits, see alignment E=5.3e-101

Best Hits

Predicted SEED Role

"TonB-dependent receptor, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G424 at UniProt or InterPro

Protein Sequence (847 amino acids)

>Echvi_3826 Outer membrane receptor proteins, mostly Fe transport (Echinicola vietnamensis KMM 6221, DSM 17526)
MIKTKAKYMKLTIQNVGILMLLLVGMGKMALAQEASSSSGNDYQLTGTVVAAEGGAPIAY
ATVLLLEESTDKQVSGGVADDEGKFFITGFGPGTYKLQVNFVGFAPYQKSGIKVSSGQKN
LSLGNIGLEEESVSLDEVTVQGQRELITEKVDRTIYNAENDKTTVGGDATDVLRRVPMLS
VDLDGNVSMRGSSNIRVLIDNKPSTMSASSIADALKQIPADEIKSVEVITSPSAKYDAEG
TGGVINIVTKKNNLQGTSLSINTSAGMRGSNLGLNASARKGKWGFNLGGFGRAGYNINGA
FENSQLVTNPDGSVSNILQTTDTRSNMLMGRYNFGADYEIDKYNWLAASVNFGMFNFKNK
QDNLLTENYLDDELISSLMRTVDMDNLSNTVDVSLNYTRTYEKPQKEFSIMGLYSRNNRT
NDFVQALLDGNFEEIAQRTKNENASNNQEFTLQVDYITPLGDGEDQILEYGAKNILRRVN
SDYAYFTAEGADGEYVENEDADFSNEFDYDQNVTAGYVSYTQGFLKHYTAKVGARYEYTT
INADFKTGEEQADIPDYGVLVPSVNLSRKFESGNMLKAAYNRRIQRPSLQFLNPNIQGAN
PTQITQGNPLLDPEYTDNFELAYSTYFKSASINISSFYRNTTGSIQPIRSVLDDGVIYTT
YENIGSEQAVGLNLFANINVSNKLSFNGGIDTYYAMIDNNVDDPLYNASNEGFVVSGRMF
GNYNITESWVLQGFAFARGRRVNLQGYETGFGIYGLNINKQFAEKKGSIGFGAENFFTPE
FKMENEIVSPTIIQHSTNYMRNMNFKINFSYRIGKMSVSPRRKKRSIENEDLKGGDSNGG
GMMGPAQ