Protein Info for Echvi_3823 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02779: Transket_pyr
  • amino acids 3 to 177 (175 residues), 148.9 bits, E=1.8e-47
• PF02780: Transketolase_C
  • amino acids 193 to 312 (120 residues), 127 bits, E=6e-41
• PF17147: PFOR_II
  • amino acids 202 to 283 (82 residues), 29.1 bits, E=1.7e-10

Best Hits

Swiss-Prot: 53% identical to ODPB1_ORYSJ: Pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial (Os08g0536000) from Oryza sativa subsp. japonica

KEGG orthology group: K00162, pyruvate dehydrogenase E1 component subunit beta [EC: 1.2.4.1] (inferred from 78% identity to sli:Slin_5165)

MetaCyc: 50% identical to pyruvate dehydrogenase E1 component beta subunit (Homo sapiens)

Predicted SEED Role

"Pyruvate dehydrogenase E1 component beta subunit (EC 1.2.4.1)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.4.1)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• TCA cycle III (animals) (8/10 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• TCA cycle II (plants and fungi) (7/9 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (19/26 steps found)
• pyruvate fermentation to acetate V (2/3 steps found)
• superpathway of glyoxylate bypass and TCA (8/12 steps found)
• pyruvate fermentation to acetate II (1/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (1/4 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.1

Use Curated BLAST to search for 1.2.4.1

Sequence Analysis Tools

See L0G5D3 at UniProt or InterPro

Protein Sequence (326 amino acids)

>Echvi_3823 Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MREIQFREALREAMSEEMRRDKNVFLMGEEVAEYNGAYKVTQGMLDEFGPDRVIDTPISE
GGFAGLGVGAGMNGLRPIIEFMTFNFSLVAIDQIVNSAAKMYAMSGGAYNVPIVFRGPTG
NAGQLGATHSSNFENWFANTPGLKVVVPSNPYDAKGLLKAAIRDDDPVIFMESELMYSDK
GEVPEGEYLLPIGVADIKRKGADVTIVSFGKIMKVALEAAEELAKDGIEAEVIDLRTVRP
IDYATVYESVKKTNRCVVVEEANPISSLATDLAFNIQKNMFDYLDAPVLRVNSMDIPLSY
APTYIEATLPNVKRTIEAVKQVTYVK