Protein Info for Echvi_3799 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Nucleoside-diphosphate-sugar epimerases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF01370: Epimerase" amino acids 4 to 239 (236 residues), 169.6 bits, see alignment E=2.4e-53 PF01073: 3Beta_HSD" amino acids 5 to 218 (214 residues), 31.4 bits, see alignment E=3e-11 PF16363: GDP_Man_Dehyd" amino acids 5 to 301 (297 residues), 163.5 bits, see alignment E=2.9e-51 PF07993: NAD_binding_4" amino acids 65 to 190 (126 residues), 20.4 bits, see alignment E=7.8e-08

Best Hits

Swiss-Prot: 62% identical to UXS5_ARATH: UDP-glucuronic acid decarboxylase 5 (UXS5) from Arabidopsis thaliana

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 79% identity to hhe:HH0647)

MetaCyc: 66% identical to UDP-xylose synthase 1 subunit (Sinorhizobium meliloti 1021)
UDP-glucuronate decarboxylase. [EC: 4.1.1.35]

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46

Use Curated BLAST to search for 4.1.1.35 or 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G4T8 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Echvi_3799 Nucleoside-diphosphate-sugar epimerases (Echinicola vietnamensis KMM 6221, DSM 17526)
MKRILVTGGSGFLGSHLCDRLLKEGNEVLCVDNLFTGRKSNIHHLLDEKNFEFLRHDITF
PLYVEVDEIYNLACPASPVHYQFDPVQTAKTSVIGAINMLGLAKRLKVRILQASTSEVYG
DPELHPQPESYKGSVNTTGIRACYDEGKRCAETLFFDYHRQHGVDIKVMRIFNTYGPRMH
PNDGRVVSNFIVQALKGEDITIFGDGLQTRSFCYVEDLIEGMYRLMNSRDGFTGPVNIGN
PGEFTMLELAQEILDLVGSGSQLKFLPLPQDDPMQRQPIIHMAKKELGWEPKVRLREGLI
ETINYFDRILKVPV