Protein Info for Echvi_3771 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Transcriptional regulators

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00392: GntR" amino acids 12 to 75 (64 residues), 77.1 bits, see alignment E=9.7e-26 PF08279: HTH_11" amino acids 39 to 70 (32 residues), 27.4 bits, see alignment 3.9e-10 PF07729: FCD" amino acids 103 to 230 (128 residues), 77.2 bits, see alignment E=2.2e-25

Best Hits

Predicted SEED Role

"Transcriptional regulator, GntR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0G3U9 at UniProt or InterPro

Protein Sequence (246 amino acids)

>Echvi_3771 Transcriptional regulators (Echinicola vietnamensis KMM 6221, DSM 17526)
MEFSEIGNRKSLSEQVEEVLTQSIRDGKYLPGQKIPTENELSKAFNVSRTAIREAIKTLS
ARGIVVVKKGSGAFVSEVSVQNASEMLNMFFELSSDKDLMLQTIEARRILEPRIAAEAAI
KRTEEDIQLLEKNMDAMRACPLEDKQFEAELDNDYHRILLSIADNKVLELLLSPVFSLMP
KFKMNVFAKPASGNLEAEKAIMLQHHQEILEAVIRQDPYGAQEAMEKHLHDTRKNYLHVI
KSIDRT